PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G312300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 164aa    MW: 15542.1 Da    PI: 10.0725
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G312300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP64.52.4e-20117163248
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                           Cqve+C+ad+   k+y+rrhkvC++h ka+vvl++gl+qrfCqqCsr
  Sobic.002G312300.2.p 117 CQVERCNADMGVEKRYNRRHKVCDAHRKASVVLLAGLRQRFCQQCSR 163
                           **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-21110163IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.392114163IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-19115163IPR004333Transcription factor, SBP-box
PfamPF031103.5E-15117163IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MPDSSFASTG MAPSSSAAAS MAALAAAAAS GDGSDDSGAA KNGGAPPTHG VEAGNNPAEL  60
AAAVGGASSS SSRAAARSRV AAAAGASGSS PVAAARSRGA GAVAAAAGGG GGVGPSCQVE  120
RCNADMGVEK RYNRRHKVCD AHRKASVVLL AGLRQRFCQQ CSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-171171631157squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0682921e-77BT068292.2 Zea mays full-length cDNA clone ZM_BFb0099E12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150236.13e-30uncharacterized protein LOC100283866
TrEMBLA0A096QYZ42e-33A0A096QYZ4_MAIZE; Uncharacterized protein
STRINGGRMZM2G067624_P027e-32(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.23e-17squamosa promoter binding protein-like 8